Domain assigned by cuff on 15 Feb 2008 15:40
same superfamily
CATH Domain: 1br7003
1br7003
PDB 1br7, Chain 1br70, Domain 3
Segment boundaries for domain 1br7003
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1br7001 | 30 | 176 |
| 1br7002 | 229 | 376 |
| 1br7003 | 430 | 546 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1br7003 SVSKRLQQELRTLLMSGDPGITAFPDGDNLFKWVATLDGPKDTVYESLKYKLTLEFPSDYPYKPPVVKFTTPCWHPNVDQ SGNICLDILKENWTASYDVRTILLSLQSLLGEPNNAS
Domain History Events (46)
Domain assignment manual match h by tronnberg on 11 Dec 2007 10:13
SSAP: 91.7 OV: 80 SEQ: 72. Different functions.
Homcheck review by tronnberg on 11 Dec 2007 10:13
SSAP: 91.7 OV: 80 SEQ: 72. Different functions.
Flow stage update by tronnberg on 11 Dec 2007 10:13
SSAP: 91.7 OV: 80 SEQ: 72. Different functions.
Homcheck allotment by tronnberg on 11 Dec 2007 10:11
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 11 Dec 2007 10:11
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Dec 2007 15:22
Domain "1br7003" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Dec 2007 15:22
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1br7003
Flow stage update by auto on 09 Dec 2007 06:32
Retrieved PRC_PFAMCATH results for job ID SID0607182261321504 and results inserted.
Domain scan prc pfamcath by auto on 09 Dec 2007 06:31
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 36 results for 1br7003
Update comment by auto on 09 Dec 2007 03:24
PRC_PFAMCATH job SID0607182261321504 is not yet finished.
Flow stage update by auto on 09 Dec 2007 03:21
The entry "1br7003" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 09 Dec 2007 03:21
The entry "1br7003" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Dec 2007 02:56
Retrieved SSAP results for job ID SID8818673098117431 and results inserted.
Domain scan ssap cath by auto on 09 Dec 2007 02:52
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2714 results for 1br7003
Update comment by auto on 08 Dec 2007 03:17
SSAP job SID8818673098117431 is not yet finished.
Flow stage update by auto on 08 Dec 2007 02:54
The entry "1br7003" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 08 Dec 2007 02:54
The entry "1br7003" has been submitted to the SSAP webservice.
Flow stage update by auto on 08 Dec 2007 02:49
Retrieved PRC results for job ID SID2935072095643616 and inserted them into the database.
Domain scan prc cath by auto on 08 Dec 2007 02:48
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 1br7003
Update comment by auto on 07 Dec 2007 19:37
PRC job SID2935072095643616 is not yet finished.
Flow stage update by auto on 07 Dec 2007 19:31
The entry "1br7003" has been submitted to the PRC webservice.
Prc cath submit by auto on 07 Dec 2007 19:31
The entry "1br7003" has been submitted to the PRC webservice.
Flow stage update by auto on 07 Dec 2007 19:25
Retrieved HMM(SAM) results for job ID SID3333861996521848 and inserted them into the database.
Domain scan sam cath by auto on 07 Dec 2007 19:25
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 14 results for 1br7003
Update comment by auto on 07 Dec 2007 14:37
HMM(SAM) job SID3333861996521848 is not yet finished.
Flow stage update by auto on 07 Dec 2007 14:32
The entry "1br7003" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 07 Dec 2007 14:32
The entry "1br7003" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 07 Dec 2007 14:25
Retrieved "1br7003" CATHEDRAL results for job ID SID8355999420352012 and inserted them into the database.
Domain scan cathedral cath by auto on 07 Dec 2007 14:24
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 61 results for 1br7003
Update comment by auto on 06 Dec 2007 06:24
"1br7003" CATHEDRAL job SID8355999420352012 is not yet finished.
Cathedral cath submit by auto on 06 Dec 2007 06:22
The entry "1br7003" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 06 Dec 2007 06:22
The entry "1br7003" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 06 Dec 2007 06:21
ScanList with 11651 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1br7003.scanlist" for "1br7003"
Write scan list by auto on 06 Dec 2007 06:21
Writing ScanList containing 11651 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1br7003.scanlist" for domain "1br7003"
Flow stage update by auto on 13 Nov 2007 00:27
No satisfactory AssignClose result found.
Flow stage update by auto on 13 Nov 2007 00:14
No in_process hits for Domain "1br7003" ready to be processed
Update comment by auto on 03 Sep 2007 20:10
Domain "1br7003" hits Domain "2a7lB00" (35.8974358974359% over 81.6176470588235%) which is currently in process
Update comment by auto on 03 Sep 2007 11:17
Domain "1br7003" hits Domain "2a7lB00" (35.8974358974359% over 81.6176470588235%) which is currently in process
Update comment by auto on 17 Aug 2007 14:08
Domain "1br7003" hits Domain "2a7lB00" (35.8974358974359% over 81.6176470588235%) which is currently in process
Update comment by auto on 17 Aug 2007 11:29
Domain "1br7003" hits Domain "1br7001" (100% over 79.5918367346939%) which is currently in process
Flow stage update by auto on 17 Aug 2007 11:29
Domain "1br7003" hits Domain "1br7001" (100% over 79.5918367346939%) which is currently in process
Flow stage update by auto on 17 Aug 2007 11:29
NW result present for Domain "1br7003"
Flow stage update by auto on 16 Aug 2007 17:14
All required files are present for Domain "1br7003"
Flow stage update by auto on 16 Aug 2007 00:02
Beginning processing for Domain "1br7003"
Insertion by cuff on 15 Aug 2007 13:04
nice chopping
