CATH Domain: 1bobA03 XML data for domain: 1bobA03

Molscript image for 1bobA03
1bobA03
PDB coordinates for domain 1bobA03

PDB 1bob, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.390 Gene3D
1.10.10.390.1
1.10.10.390.1.1
1.10.10.390.1.1.1
1.10.10.390.1.1.1.1
1.10.10.390.1.1.1.1.1

[top]
Segment boundaries for domain 1bobA03

Chopping figure for domain 1bobA03
DomainStart PDB ResidueStop PDB Residue
1bobA01 6 115
1bobA01 145 162
1bobA02 116 144
1bobA02 163 266
1bobA03 267 320

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.10.390.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2dflA01 79.15 DNA repair and recombination protein radASulfolobus solfataricusDNA repair protein RadA 1.10.150.20 60 3 78 3.48 4.44
2z43B01 78.80 DNA repair and recombination protein radASulfolobus solfataricusDNA repair protein RadA 1.10.150.20 64 3 75 3.20 4.27
1hq1A00 78.07 Protein exportBacterial secretion systemEscherichia coli O157:H7Signal recognition particle proteinSignal recognition particle subunit SRP54 1.10.260.30 76 7 71 3.31 4.66
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bobA03
RNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bobA03
RNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bob003" to "1bobA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:13

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"