CATH Domain: 1bobA01 XML data for domain: 1bobA01

Molscript image for 1bobA01
1bobA01
PDB coordinates for domain 1bobA01

PDB 1bob, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.360 Histone Acetyltransferase; domain 1
3.90.360.10 Histone Acetyltransferase; Domain 1 Gene3D
3.90.360.10.1
3.90.360.10.1.1
3.90.360.10.1.1.1
3.90.360.10.1.1.1.1
3.90.360.10.1.1.1.1.1

[top]
Segment boundaries for domain 1bobA01

Chopping figure for domain 1bobA01
DomainStart PDB ResidueStop PDB Residue
1bobA01 6 115
1bobA01 145 162
1bobA02 116 144
1bobA02 163 266
1bobA03 267 320

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1bobA01
FKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEK
KLLSFLPKDDVIVRDEAKWVDCFAEERKTHFARRMHRRVQIFSLLFIE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bobA01
MSANDFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNI
VDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHFARRMHRRVQIFSLLFIE
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bob001" to "1bobA01" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:13

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"