CATH Domain: 1bjtA04 XML data for domain: 1bjtA04

Molscript image for 1bjtA04
1bjtA04
PDB coordinates for domain 1bjtA04

PDB 1bjt, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.40 Gene3D
3.30.1360.40.7
3.30.1360.40.7.1
3.30.1360.40.7.1.1
3.30.1360.40.7.1.1.1
3.30.1360.40.7.1.1.1.2

Segment boundaries for domain 1bjtA04

Chopping figure for domain 1bjtA04
DomainStart PDB ResidueStop PDB Residue
1bjtA01 575 617
1bjtA02 421 574
1bjtA02 618 681
1bjtA03 1009 1149
1bjtA04 872 973
1bjtA05 682 871
1bjtA05 974 1008
1bjtA05 1150 1173

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1bjtA04
WTGTIEEIEPLRYRMYGRIEQIGDNVLEITELPARTWTSTIKEYLLLGLSGNDKIKPWIKDMEEQHDDNIKFIITLSPEE
MAKTRKIGFYERFKLISPISLM    

Domain COMBS Sequence

>pdb|1bjtA04
WTGTIEEIEPLRYRMYGRIEQIGDNVLEITELPARTWTSTIKEYLLLGLSGNDKIKPWIKDMEEQHDDNIKFIITLSPEE
MAKTRKIGFYERFKLISPISLM    

Domain History Events (5)

Classification merge by cuff on 27 Jun 2008 15:56

COMMENT: Both type II DNA topoisomerases; both assemble as dimers.
Merge 3.30.1360.50 into 3.30.1360.40 FINAL: yep - merge 3.30.1360.50 into 3.30.1360.40

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bjt004" to "1bjtA04" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"