Domain assigned by lewis on 18 Jan 2007 18:57
Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1bgxT01 | 1 | 176 |
| 1bgxT01 | 250 | 283 |
| 1bgxT02 | 177 | 249 |
| 1bgxT03 | 300 | 446 |
| 1bgxT04 | 447 | 561 |
| 1bgxT05 | 562 | 613 |
| 1bgxT05 | 758 | 831 |
| 1bgxT06 | 614 | 757 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1bgxT02 DQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVR
Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.
Rechopping chains just before release v3.1.0 in order to fix missing fragments.