CATH Domain: 1bgwA01 XML data for domain: 1bgwA01

Molscript image for 1bgwA01
1bgwA01
PDB coordinates for domain 1bgwA01

PDB 1bgw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.30 Gene3D
3.30.1490.30.1
3.30.1490.30.1.1
3.30.1490.30.1.1.1
3.30.1490.30.1.1.1.1
3.30.1490.30.1.1.1.1.2

[top]
Segment boundaries for domain 1bgwA01

Chopping figure for domain 1bgwA01
DomainStart PDB ResidueStop PDB Residue
1bgwA01 563 605
1bgwA02 420 562
1bgwA02 606 633
1bgwA03 1010 1150
1bgwA04 873 974
1bgwA05 683 872
1bgwA05 975 1009
1bgwA05 1151 1178

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.1490.30.1.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bjtA01 85.22 Reciprocal meiotic recombinationRegulation of mitotic recombinationDNA topoisomerase 2DNA strand elongation involved in DNA replicationDNA topoisomerase II [EC:5.99.1.3] 3.30.1490.30 43 79 72 1.64 2.27
3c6mC01 80.69 Spermine synthaseArginine and proline metabolismSpermine synthase [EC:2.5.1.22]Glutathione metabolismMetabolic pathways 3.30.160.110 44 2 85 2.70 3.17
1b33N01 79.13 Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, coreMastigocladus laminosus 3.30.1490.170 55 10 70 2.42 3.41
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bgwA01
PIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQKYYKG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bgwA01
PIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQKYYKG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bgw001" to "1bgwA01" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"