CATH Domain: 1bgvA03 XML data for domain: 1bgvA03

Molscript image for 1bgvA03
1bgvA03
PDB coordinates for domain 1bgvA03

PDB 1bgv, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.285 Glutamate Dehydrogenase; Chain A, domain 3
1.10.285.10 Glutamate Dehydrogenase, chain A, domain 3 Gene3D
1.10.285.10.1
1.10.285.10.1.1
1.10.285.10.1.1.1
1.10.285.10.1.1.1.1
1.10.285.10.1.1.1.1.1

[top]
Segment boundaries for domain 1bgvA03

Chopping figure for domain 1bgvA03
DomainStart PDB ResidueStop PDB Residue
1bgvA01 207 373
1bgvA02 52 187
1bgvA03 1 51
1bgvA03 425 449

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1bgvA03
SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMNLVAGANIVGFQKIADAMMAQGIAW
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bgvA03
SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMNLVAGANIVGFQKIADAMMAQGIAW
BLAST against CATH

[top]
Domain History Events (2)

Domain assigned by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.

Insertion by lewis on 09 Aug 2006 17:11

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the chopping is being reinserted but with the segments reordered in the domains. The domains should not be reordered. This work is done under ticket:98.