Domain assigned by lewis on 09 Aug 2006 17:12
Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1bgvA01 | 207 | 373 |
| 1bgvA02 | 52 | 187 |
| 1bgvA03 | 1 | 51 |
| 1bgvA03 | 425 | 449 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1bgvA03 SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMNLVAGANIVGFQKIADAMMAQGIAW
Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.
Automatically fixing a bunch of choppings that have domains with misordered segments. Here the chopping is being reinserted but with the segments reordered in the domains. The domains should not be reordered. This work is done under ticket:98.