CATH Domain: 1bgcA00 XML data for domain: 1bgcA00

Molscript image for 1bgcA00
1bgcA00
PDB coordinates for domain 1bgcA00

PDB 1bgc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.4
1.20.1250.10.4.1
1.20.1250.10.4.1.1
1.20.1250.10.4.1.1.1
1.20.1250.10.4.1.1.1.1

[top]
Segment boundaries for domain 1bgcA00

Chopping figure for domain 1bgcA00
DomainStart PDB ResidueStop PDB Residue
1bgcA00 9 173

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1aluA00 87.15 Positive regulation of smooth muscle cell proliferationJak-STAT signaling pathwayPrion diseasesAcute-phase responsePositive regulation of T cell proliferation 1.20.1250.10 157 12 89 2.40 2.69
1cnt200 86.58 Jak-STAT signaling pathwayCiliary neurotrophic factorCiliary neurotrophic factor receptor bindingCiliary neurotrophic factorCytokine-cytokine receptor interaction 1.20.1250.10 130 21 77 2.46 3.19
1i1rB00 84.59 Interleukin-6 homologHuman herpesvirus 8 1.20.1250.10 167 14 89 2.90 3.23
1wu3I00 83.53 Jak-STAT signaling pathwayInterferon, betaChagas diseaseCytokine activityNatural killer cell mediated cytotoxicity 1.20.1250.10 161 8 88 3.67 4.16
1ax8A00 83.40 Jak-STAT signaling pathwayLeptinNeuroactive ligand-receptor interactionAdipocytokine signaling pathwayCytokine-cytokine receptor interaction 1.20.1250.10 130 10 75 3.65 4.85
3d48P00 83.16 Jak-STAT signaling pathwayPositive regulation of JAK-STAT cascadeRegulation of multicellular organism growthProlactin receptor bindingCell proliferation 1.20.1250.10 165 8 90 4.18 4.63
1lkiA00 82.73 Negative regulation of ERK1 and ERK2 cascadeCytokine activityLung vasculature developmentBlood vessel remodelingLung lobe morphogenesis 1.20.1250.10 172 10 87 4.36 5.00
1f45B00 79.96 Positive regulation of interferon-gamma productionPositive regulation of tyrosine phosphorylation of Stat4 proteinPositive regulation of smooth muscle cell apoptosisPositive regulation of cell adhesionInterleukin-27 binding 1.20.1250.10 133 10 70 3.37 4.80
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bgcA00
SLPQSFLLKCLEQVRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQAPLSSCSSQSLQLRGCLNQLHGGLFLYQG
LLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDLGAAPAMPTFTSAFQRRAGGVLVASQLHRFLELAYRGLRYLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bgcA00
TPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQAPLSSCSSQSLQLRGCLNQLHG
GLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDLGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRF
LELAYRGLRYLAEP
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bgc000" to "1bgcA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"