CATH Domain: 1bg6A02 XML data for domain: 1bg6A02

Molscript image for 1bg6A02
1bg6A02
PDB coordinates for domain 1bg6A02

PDB 1bg6, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1040 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2
1.10.1040.10 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 Gene3D
1.10.1040.10.4
1.10.1040.10.4.1
1.10.1040.10.4.1.1
1.10.1040.10.4.1.1.1
1.10.1040.10.4.1.1.1.1

[top]
Segment boundaries for domain 1bg6A02

Chopping figure for domain 1bg6A02
DomainStart PDB ResidueStop PDB Residue
1bg6A01 4 195
1bg6A02 196 348

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1040.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ew2A02 80.17 2-dehydropantoate 2-reductase [EC:1.1.1.169]Pantothenate and CoA biosynthesis2-dehydropantoate 2-reductaseMetabolic pathwaysEnterococcus faecalis 1.10.1040.10 132 15 76 3.78 4.93
1ks9A02 79.92 Pantothenate and CoA biosynthesisMetabolic pathways2-dehydropantoate 2-reductase [EC:1.1.1.169]2-dehydropantoate 2-reductase activityPantothenate biosynthetic process from valine 1.10.1040.10 123 13 69 3.23 4.67
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bg6A02
NVNAVMHPLPTLLNAARCESGTPFQYYLEGITPSVGSLAEKVDAERIAIAKAFDLNVPSVCEWYPATIYEAVQGNPAYRG
IAGPINLNTRYFFEDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLIDTDFRKEGRTLEKLGLSG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bg6A02
NVNAVMHPLPTLLNAARCESGTPFQYYLEGITPSVGSLAEKVDAERIAIAKAFDLNVPSVCEWYKESYGQSPATIYEAVQ
GNPAYRGIAGPINLNTRYFFEDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLIDTDFRKEGRTLEKLGLSG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bg6002" to "1bg6A02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"