CATH Domain: 1bg1A04 XML data for domain: 1bg1A04

Molscript image for 1bg1A04
1bg1A04
PDB coordinates for domain 1bg1A04

PDB 1bg1, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.18
3.30.505.10.18.1
3.30.505.10.18.1.1
3.30.505.10.18.1.1.1
3.30.505.10.18.1.1.1.1

[top]
Segment boundaries for domain 1bg1A04

Chopping figure for domain 1bg1A04
DomainStart PDB ResidueStop PDB Residue
1bg1A01 138 321
1bg1A02 322 466
1bg1A03 467 588
1bg1A04 589 711

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.505.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bf5A04 84.41 Jak-STAT signaling pathwayPathways in cancerChemokine signaling pathwayNucleolusProtein binding 3.30.505.10 112 56 96 3.72 3.86
2dm0A01 76.58 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 15 70 3.01 4.26
1ju5A00 76.34 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 11 69 2.89 4.14
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bg1A04
ISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGSTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVS
PLVYLYPDIPKEEAFGKYCRAAPLKTKFI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bg1A04
ISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGSTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVS
PLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPXLKTKFI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"