CATH Domain: 1bf5A04 XML data for domain: 1bf5A04

Molscript image for 1bf5A04
1bf5A04
PDB coordinates for domain 1bf5A04

PDB 1bf5, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.22
3.30.505.10.22.1
3.30.505.10.22.1.1
3.30.505.10.22.1.1.1
3.30.505.10.22.1.1.1.1

[top]
Segment boundaries for domain 1bf5A04

Chopping figure for domain 1bf5A04
DomainStart PDB ResidueStop PDB Residue
1bf5A01 136 317
1bf5A02 318 460
1bf5A03 461 581
1bf5A04 582 710

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.505.10.22.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2dm0A01 75.01 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 13 67 2.78 4.10
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bf5A04
ISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPE
NPLKYLYPNIDKDHAFGKYYSRGIKTELISVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bf5A04
ISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPE
NPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGXIKTELISVS
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"