CATH Domain: 1bboA02 XML data for domain: 1bboA02

Molscript image for 1bboA02
1bboA02
PDB coordinates for domain 1bboA02

PDB 1bbo, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.160 Double Stranded RNA Binding Domain
3.30.160.60 Classic Zinc Finger Gene3D
3.30.160.60.21
3.30.160.60.21.1
3.30.160.60.21.1.1
3.30.160.60.21.1.1.1
3.30.160.60.21.1.1.1.1

[top]
Segment boundaries for domain 1bboA02

Chopping figure for domain 1bboA02
DomainStart PDB ResidueStop PDB Residue
1bboA01 1 26
1bboA02 27 57

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.160.60.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tf3A01 87.43 Xenopus laevisTranscription factor IIIA 3.30.160.60 30 16 90 2.43 2.69
1x5wA01 87.33 Homo sapiensZinc finger protein 64 homolog, isoforms 1 and 2 3.30.160.60 28 25 90 2.27 2.51
2adrA01 86.31 NucleusRegulation of carbohydrate metabolic processPeroxisome organizationNegative regulation of transcription from RNA polymerase II promoter by glucoseRegulatory protein ADR1 3.30.160.60 29 27 90 2.53 2.80
2b0uC03 79.13 Homo sapiensNegative regulation of transcription from RNA polymerase II promoterFollistatinPositive regulation of hair follicle developmentActivin binding 3.30.60.30 41 9 73 3.15 4.30
3bidA01 75.17 Neisseria meningitidis serogroup BUPF0339 protein NMB1088 3.30.160.160 46 9 63 2.92 4.63
1bbgA00 73.88 Pollen allergen Amb t 5Ambrosia trifida 3.30.160.80 40 16 60 2.27 3.78
1ncsA00 73.84 Regulation of transcription involved in G1 phase of mitotic cell cycleNucleusProtein bindingTranscriptional factor SWI5Cytoplasm 3.30.160.60 47 19 59 2.66 4.46
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bboA02
VRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bboA02
VRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1bbo002" to "1bboA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"