CATH Domain: 1ba1A03 XML data for domain: 1ba1A03

Molscript image for 1ba1A03
1ba1A03
PDB coordinates for domain 1ba1A03

PDB 1ba1, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.18
3.30.420.40.18.1
3.30.420.40.18.1.2
3.30.420.40.18.1.2.1
3.30.420.40.18.1.2.1.1

[top]
Segment boundaries for domain 1ba1A03

Chopping figure for domain 1ba1A03
DomainStart PDB ResidueStop PDB Residue
1ba1A01 4 67
1ba1A01 123 187
1ba1A01 361 381
1ba1A02 68 122
1ba1A03 188 228
1ba1A03 313 360
1ba1A04 229 312

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.420.40.18.1.2.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qxlA03 92.52 Adenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Protein refoldingHeat shock protein 110kDaCytoplasm 3.30.420.40 93 32 94 1.41 1.49
1jcfA02 85.69 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 17 88 3.00 3.38
1e4fT04 81.81 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 15 94 4.07 4.31
1huxA01 79.38 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 11 60 2.42 4.00
3epqA01 78.71 3.30.420.40 91 7 74 3.36 4.50
2gupA01 78.26 ROK family proteinStreptococcus pneumoniae 3.30.420.40 96 7 75 3.02 4.03
3h1qA02 75.28 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 16 62 2.93 4.66
1huxA02 75.20 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 140 11 48 2.06 4.24
1dt9A02 74.07 RNA bindingEukaryotic peptide chain release factor subunit 1Protein methylationProtein bindingCytoplasm 3.30.420.60 112 10 68 3.15 4.58
1sz2B01 73.34 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismGlycolysis / Gluconeogenesis 3.30.420.40 118 11 66 3.26 4.87
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ba1A03
KVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ
DFFNGKELN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ba1A03
KVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ
DFFNGKELN
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ba1003" to "1ba1A03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"