CATH Domain: 1ba1A01 XML data for domain: 1ba1A01

Molscript image for 1ba1A01
1ba1A01
PDB coordinates for domain 1ba1A01

PDB 1ba1, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.1
3.30.420.40.1.1
3.30.420.40.1.1.2
3.30.420.40.1.1.2.1
3.30.420.40.1.1.2.1.1

[top]
Segment boundaries for domain 1ba1A01

Chopping figure for domain 1ba1A01
DomainStart PDB ResidueStop PDB Residue
1ba1A01 4 67
1ba1A01 123 187
1ba1A01 361 381
1ba1A02 68 122
1ba1A03 188 228
1ba1A03 313 360
1ba1A04 229 312

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.420.40.1.1.2.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qxlB01 89.59 ATP bindingCytoplasmAdenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Peptide binding 3.30.420.40 134 33 85 3.65 4.25
1jceA01 85.40 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 147 31 85 3.02 3.52
2q0uA01 82.08 Actin, alpha skeletal muscleActin, alpha skeletal muscleOryctolagus cuniculus 3.30.420.40 149 11 73 2.56 3.50
1huxA01 80.14 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 15 73 3.32 4.54
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ba1A01
GPAVGIDLGTTYSKVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVVLTKMKEIAEAYLGKT
VTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSINPDEAVAYGAAVQAAILS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ba1A01
MSKGPAVGIDLGTTYSKVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVVLTKMKEIAEAYL
GKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSINPDEAVAYGAAVQAAILSGDKSE
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ba1001" to "1ba1A01" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"