Set cath from cathlist by auto on 05 Mar 2006 18:30
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1b9mB01 | -1 | 107 |
| 1b9mB02 | 108 | 181 |
| 1b9mB02 | 253 | 257 |
| 1b9mB03 | 182 | 252 |
There are 17 matching structural neighberhood comparisons for CATH ID 2.40.50.100.4.1.1.1.1 (SIMAX score < 5)
>pdb|1b9mB02 ALPLNSLLAAISRFSLQTSARNQWFGTITAQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILADSVI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"