CATH Domain: 1b9lA00 XML data for domain: 1b9lA00

Molscript image for 1b9lA00
1b9lA00
PDB coordinates for domain 1b9lA00

PDB 1b9l, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1130 GTP Cyclohydrolase I, domain 2
3.30.1130.10 Gene3D
3.30.1130.10.6
3.30.1130.10.6.1
3.30.1130.10.6.1.1
3.30.1130.10.6.1.1.1
3.30.1130.10.6.1.1.1.1

[top]
Segment boundaries for domain 1b9lA00

Chopping figure for domain 1b9lA00
DomainStart PDB ResidueStop PDB Residue
1b9lA00 2 120

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.1130.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2g64A00 78.70 Caenorhabditis elegansIdentical protein binding6-pyruvoyl tetrahydrobiopterin synthase [EC:4.2.3.12]Putative 6-pyruvoyl tetrahydrobiopterin synthaseFolate biosynthesis 3.30.479.10 127 9 78 3.63 4.61
3d7jC00 78.65 Putative uncharacterized protein SCO6650Streptomyces coelicolor 3.30.479.10 133 6 81 4.01 4.94
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1b9lA00
AQPAAIIRIKNLRLRTFIGIKEEEINNRQDIVINVTIHYPADKARTSEDINDALNYRTVTKNIIQHVENNRFSLLEKLTQ
DVLDIAREHHWVTYAEVEIDKLHALRYADSVSMTLSWQR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1b9lA00
MAQPAAIIRIKNLRLRTFIGIKEEEINNRQDIVINVTIHYPADKARTSEDINDALNYRTVTKNIIQHVENNRFSLLEKLT
QDVLDIAREHHWVTYAEVEIDKLHALRYADSVSMTLSWQR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"