CATH Domain: 1b9hA02 XML data for domain: 1b9hA02

Molscript image for 1b9hA02
1b9hA02
PDB coordinates for domain 1b9hA02

PDB 1b9h, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.15
3.90.1150.10.15.1
3.90.1150.10.15.1.1
3.90.1150.10.15.1.1.1
3.90.1150.10.15.1.1.1.1

[top]
Segment boundaries for domain 1b9hA02

Chopping figure for domain 1b9hA02
DomainStart PDB ResidueStop PDB Residue
1b9hA01 16 249
1b9hA02 250 388

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mdoA02 82.91 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferaseUDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferaseNucleotide sugars metabolismTwo-component system - GeneralSalmonella typhimurium 3.90.1150.10 123 13 88 3.16 3.57
1fc4A02 80.60 Glycine, serine and threonine metabolismEscherichia coli O157:H72-amino-3-ketobutyrate coenzyme A ligaseGlycine C-acetyltransferase 3.90.1150.10 133 6 71 3.14 4.41
3dydA01 80.27 Tyrosine metabolismTyrosine aminotransferasePhenylalanine metabolismTyrosine aminotransferaseNovobiocin biosynthesis 3.90.1150.10 137 11 71 2.87 4.03
1eluA01 79.86 Synechocystis sp. PCC 6714L-cysteine/cystine lyase C-DES 3.90.1150.10 115 14 69 2.76 4.00
1jg8A02 79.40 Thermotoga maritimaGlycine, serine and threonine metabolismThreonine aldolaseL-allo-threonine aldolase 3.90.1150.10 96 16 69 2.71 3.92
1m32A01 79.22 2-aminoethylphosphonate--pyruvate transaminaseAminophosphonate metabolism2-aminoethylphosphonate-pyruvate transaminaseSalmonella typhimurium 3.90.1150.10 110 14 71 3.20 4.49
1js3A03 79.22 Tyrosine metabolismSus scrofaAromatic-L-amino-acid decarboxylaseAromatic-L-amino-acid decarboxylaseHistidine metabolism 3.90.1150.10 97 10 67 2.55 3.77
1d2fB01 78.40 Nitrogen metabolismSelenoamino acid metabolismCysteine metabolismSulfur metabolismMethionine metabolism 3.90.1150.10 124 12 71 3.30 4.63
5bj4A01 77.68 Tyrosine metabolismArginine and proline metabolismCysteine metabolismCarbon fixationGlutamate metabolism 3.90.1150.10 146 12 65 2.99 4.60
2qmaA02 76.84 Vibrio parahaemolyticusDiaminobutyrate-2-oxoglutarate transaminaseGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylase 3.90.1150.10 122 7 72 3.33 4.58
1uu2B01 76.13 Histidinol-phosphate aminotransferaseTyrosine metabolismThermotoga maritimaNovobiocin biosynthesisPhenylalanine, tyrosine and tryptophan biosynthesis 3.90.1150.10 117 7 61 2.70 4.36
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1b9hA02
ARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRT
DAFWELGAPDESVDAIARRCPNTDAISSDCVWLHHRVLLAGEPELHATAEIIADAVARA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1b9hA02
ARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRT
DAFWELGAPDESVDAIARRCPNTDAISSDCVWLHHRVLLAGEPELHATAEIIADAVARA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"