CATH Domain: 1b6aA02 XML data for domain: 1b6aA02

Molscript image for 1b6aA02
1b6aA02
PDB coordinates for domain 1b6aA02

PDB 1b6a, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.10 "winged helix" repressor DNA binding domain Gene3D
1.10.10.10.4
1.10.10.10.4.1
1.10.10.10.4.1.1
1.10.10.10.4.1.1.1
1.10.10.10.4.1.1.1.1

[top]
Segment boundaries for domain 1b6aA02

Chopping figure for domain 1b6aA02
DomainStart PDB ResidueStop PDB Residue
1b6aA01 164 371
1b6aA01 451 474
1b6aA02 372 450

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.10.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3fm3A02 91.68 Methionine aminopeptidase 2Methionyl aminopeptidase [EC:3.4.11.18]Encephalitozoon cuniculi 1.10.10.10 80 30 97 1.75 1.79
1xgsA02 91.38 Pyrococcus furiosusMethionyl aminopeptidase [EC:3.4.11.18]Methionine aminopeptidase 1.10.10.10 77 33 93 1.27 1.36
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1b6aA02
GVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1b6aA02
GVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDI
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1b6a002" to "1b6aA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"