CATH Domain: 1b63A01 XML data for domain: 1b63A01

Molscript image for 1b63A01
1b63A01
PDB coordinates for domain 1b63A01

PDB 1b63, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.5
3.30.565.10.5.1
3.30.565.10.5.1.1
3.30.565.10.5.1.1.1
3.30.565.10.5.1.1.1.1

[top]
Segment boundaries for domain 1b63A01

Chopping figure for domain 1b63A01
DomainStart PDB ResidueStop PDB Residue
1b63A01 1 216
1b63A02 217 330

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.565.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h7sA01 85.83 DNA mismatch repair protein PMS2Mismatch repair endonuclease PMS2Single base insertion or deletion bindingHomo sapiensMismatch repair 3.30.565.10 191 26 83 2.77 3.32
1mu5A01 82.08 Type 2 DNA topoisomerase 6 subunit BSulfolobus shibatae 3.30.565.10 210 16 83 3.44 4.11
3fv5B00 80.94 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 181 14 74 2.90 3.89
1s14B00 79.87 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 178 14 73 2.92 3.99
1pvgA01 79.53 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.565.10 238 12 78 3.26 4.13
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1b63A01
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKI
ASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKF
LRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAIC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1b63A01
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKI
ASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKF
LRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAIC
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"