CATH Domain: 1b5lA00 XML data for domain: 1b5lA00

Molscript image for 1b5lA00
1b5lA00
PDB coordinates for domain 1b5lA00

PDB 1b5l, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.11
1.20.1250.10.11.1
1.20.1250.10.11.1.1
1.20.1250.10.11.1.1.1
1.20.1250.10.11.1.1.1.1

[top]
Segment boundaries for domain 1b5lA00

Chopping figure for domain 1b5lA00
DomainStart PDB ResidueStop PDB Residue
1b5lA00 1 164

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wu3I00 88.04 Jak-STAT signaling pathwayInterferon, betaChagas diseaseCytokine activityNatural killer cell mediated cytotoxicity 1.20.1250.10 161 26 91 2.89 3.17
3d48P00 84.40 Jak-STAT signaling pathwayPositive regulation of JAK-STAT cascadeRegulation of multicellular organism growthProlactin receptor bindingCell proliferation 1.20.1250.10 165 8 87 3.77 4.32
1f45B00 81.04 Positive regulation of interferon-gamma productionPositive regulation of tyrosine phosphorylation of Stat4 proteinPositive regulation of smooth muscle cell apoptosisPositive regulation of cell adhesionInterleukin-27 binding 1.20.1250.10 133 10 73 3.23 4.38
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1b5lA00
CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTT
LLEQLCTGLQQQLDHLDTCRGMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1b5lA00
CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTT
LLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQK
RLTKMGGDLNSP
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1b5l000" to "1b5lA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"