CATH Domain: 1b4bA00 XML data for domain: 1b4bA00

Molscript image for 1b4bA00
1b4bA00
PDB coordinates for domain 1b4bA00

PDB 1b4b, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.40 Gene3D
3.30.1360.40.4
3.30.1360.40.4.1
3.30.1360.40.4.1.1
3.30.1360.40.4.1.1.1
3.30.1360.40.4.1.1.1.1

[top]
Segment boundaries for domain 1b4bA00

Chopping figure for domain 1b4bA00
DomainStart PDB ResidueStop PDB Residue
1b4bA00 79 149

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.30.1360.40.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2phcB01 83.85 Pyrococcus horikoshiiPutative uncharacterized protein PH0987 3.30.1360.40 83 9 77 2.33 3.02
1in0A01 83.56 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 11 78 2.30 2.92
3bp8C00 83.53 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 75 9 86 2.46 2.84
3bp3A00 81.46 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 79 9 82 2.56 3.11
1cc8A00 78.66 Copper chaperone activityMetal homeostasis factor ATX1Protein bindingCytosolCopper ion transport 3.30.70.100 72 5 75 3.71 4.95
1vjqA00 78.33 3.30.70.340 71 8 78 3.43 4.35
1sqgA03 77.92 Ribosomal RNA small subunit methyltransferase B [EC:2.1.1.-]Ribosomal RNA small subunit methyltransferase BRRNA (cytosine-C5-)-methyltransferase activityRRNA base methylationEscherichia coli K-12 3.30.70.1170 58 12 66 2.72 4.11
1i1gA02 77.51 Pyrococcus furiosusHTH-type transcriptional regulator lrpALrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA 3.30.70.920 77 5 71 3.27 4.58
1uw4A00 76.05 Regulator of nonsense transcripts 3BNuclear-transcribed mRNA catabolic process, nonsense-mediated decayHomo sapiensProtein binding 3.30.70.330 90 8 64 2.92 4.53
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1b4bA00
ALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1b4bA00
ALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"