Set cath from cathlist by auto on 05 Mar 2006 19:31
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1b25A01 | 1 | 209 |
| 1b25A02 | 239 | 416 |
| 1b25A03 | 210 | 238 |
| 1b25A03 | 417 | 608 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1b25A01 MYGWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEARGVEPLSPENKLIFAAGPFNGLPTPSGGKLVVAA KSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPVYIYIEDDNVSILSAEGLWGKTTFETERELKEIHGKNVGVLT IGPAGENLVKYAVVISQEGRAAGRPGMGAVMGSKKLKAVVIRGTKEIPV
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"