Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.150.20.27.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1hq1A00 | 75.39 | 1.10.260.30 | 76 | 5 | 82 | 3.85 | 4.64 | |
![]() |
1wcnA01 | 70.61 | 1.10.150.20 | 60 | 18 | 81 | 3.82 | 4.69 |
>pdb|1b22A00 EEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"