Set cath from cathlist by auto on 05 Mar 2006 18:49
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1b12A01 | 77 | 153 |
| 1b12A01 | 263 | 323 |
| 1b12A02 | 154 | 188 |
| 1b12A02 | 224 | 262 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.170.230.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1t7dA02 | 89.87 | 2.170.230.10 | 99 | 90 | 67 | 0.42 | 0.62 |
>pdb|1b12A02 KVTYDPVSKELTIQPGCSSGQACENALPVTYSNVESERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"