CATH Domain: 1azsB00 XML data for domain: 1azsB00

Molscript image for 1azsB00
1azsB00
PDB coordinates for domain 1azsB00

PDB 1azs, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.1230 Adenylyl Cyclase, chain A Gene3D
3.30.70.1230.3
3.30.70.1230.3.1
3.30.70.1230.3.1.1
3.30.70.1230.3.1.1.1
3.30.70.1230.3.1.1.1.1

[top]
Segment boundaries for domain 1azsB00

Chopping figure for domain 1azsB00
DomainStart PDB ResidueStop PDB Residue
1azsB00 879 1077

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1azsB00
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMH
IGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLI
LQTLGYTCTCRGIINVKGKGDLKTYFVNT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1azsB00
RSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATG
LSAIPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASR
MDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSR
BLAST against CATH

[top]
Domain History Events (5)

Classification move by cuff on 26 Apr 2006 17:02

Moving Classification[<3.50.6.10> "Adenylyl Cyclase, chain A" [ACTIVE]] to Classification[<3.30.70.1230> "Adenylyl Cyclase, chain A"]:
Lesley - No, 1w25A03 is an a/b-plait with embellishments so it should not have its architecture changed. Do not merge H-levels without better scores. 1fx2A00 has so much embellishment it has significantly deviated from a core a/b-plait fold that it contains. We can't be sure of ancestry here. But we can merge T-levels. SCOP concurrs. Go to 3.30.70 but new H-level with the name (Adenylyl and guanylyl cyclase catalytic domain). Remember to move only the entire H-level (.10).

Flow stage update by cuff on 26 Apr 2006 17:02

Moving Classification[<3.50.6.10> "Adenylyl Cyclase, chain A" [ACTIVE]] to Classification[<3.30.70.1230> "Adenylyl Cyclase, chain A"]:
Lesley - No, 1w25A03 is an a/b-plait with embellishments so it should not have its architecture changed. Do not merge H-levels without better scores. 1fx2A00 has so much embellishment it has significantly deviated from a core a/b-plait fold that it contains. We can't be sure of ancestry here. But we can merge T-levels. SCOP concurrs. Go to 3.30.70 but new H-level with the name (Adenylyl and guanylyl cyclase catalytic domain). Remember to move only the entire H-level (.10).

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:53

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"