CATH Domain: 1ayaA00 XML data for domain: 1ayaA00

Molscript image for 1ayaA00
1ayaA00
PDB coordinates for domain 1ayaA00

PDB 1aya, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.13
3.30.505.10.13.1
3.30.505.10.13.1.1
3.30.505.10.13.1.1.1
3.30.505.10.13.1.1.1.1

[top]
Segment boundaries for domain 1ayaA00

Chopping figure for domain 1ayaA00
DomainStart PDB ResidueStop PDB Residue
1ayaA00 3 103

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.30.505.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i3zA00 88.78 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 33 93 1.78 1.91
1milA00 88.06 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 24 92 1.90 2.06
2oq1A01 87.54 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 27 87 1.84 2.09
2dm0A01 87.09 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 27 89 1.92 2.15
2crhA01 86.85 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 25 96 2.43 2.53
2iugA00 86.78 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 25 88 2.27 2.57
2kk6A00 85.26 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 27 81 2.18 2.66
2vifA01 85.17 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 25 79 2.27 2.86
1ju5A00 84.13 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 27 82 2.22 2.69
2pldA00 83.53 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 29 88 2.55 2.88
1rpyB00 82.59 SH2B adapter protein 2Nervous system developmentRattus norvegicusInsulin signaling pathwayNeurotrophin signaling pathway 3.30.505.10 85 21 73 3.43 4.68
3cxlA01 82.08 N-chimaerinHomo sapiensSH3/SH2 adaptor activity 3.30.505.10 104 17 79 3.27 4.10
1bg1A04 75.94 Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane 3.30.505.10 109 14 70 3.06 4.33
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ayaA00
MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYM
EHHGQLKEKNGDVIELKYPLN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ayaA00
MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYM
EHHGQLKEKNGDVIELKYPLN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"