CATH Domain: 1aw9A02 XML data for domain: 1aw9A02

Molscript image for 1aw9A02
1aw9A02
PDB coordinates for domain 1aw9A02

PDB 1aw9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.23
1.20.1050.10.23.1
1.20.1050.10.23.1.1
1.20.1050.10.23.1.1.1
1.20.1050.10.23.1.1.1.1

[top]
Segment boundaries for domain 1aw9A02

Chopping figure for domain 1aw9A02
DomainStart PDB ResidueStop PDB Residue
1aw9A01 3 87
1aw9A02 88 208

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.23.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gnwA02 93.08 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 42 96 1.14 1.19
1hqoA02 85.22 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 19 87 2.75 3.15
1nhyA02 84.54 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 17 83 2.85 3.42
1v2aA02 84.08 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 19 84 2.32 2.76
2c3nA02 81.63 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 17 75 2.21 2.95
3cbuA02 81.15 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 23 88 3.17 3.58
1gwcA02 79.18 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 12 75 3.36 4.43
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1aw9A02
PATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADA
NHASYLLYLSKTPKAGLVAARPHVKAWWEAIVARPAFQKTV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1aw9A02
PATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADA
NHASYLLYLSKTPKAGLVAARPHVKAWWEAIVARPAFQKTV
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1aw9002" to "1aw9A02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:09

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"