CATH Domain: 1atxA00 XML data for domain: 1atxA00

Molscript image for 1atxA00
1atxA00
PDB coordinates for domain 1atxA00

PDB 1atx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.20 Anthopleurin-A
2.20.20.10 Anthopleurin-A Gene3D
2.20.20.10.2
2.20.20.10.2.1
2.20.20.10.2.1.1
2.20.20.10.2.1.1.1
2.20.20.10.2.1.1.1.1

[top]
Segment boundaries for domain 1atxA00

Chopping figure for domain 1atxA00
DomainStart PDB ResidueStop PDB Residue
1atxA00 1 46

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.20.20.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1fd3A00 79.41 Homo sapiensBeta-defensin 2Immune responseG-protein coupled receptor protein signaling pathwayChemotaxis 3.10.360.10 41 14 84 4.03 4.75
1wqkA00 78.13 Toxin APETx1Anthopleura elegantissima 2.20.20.10 42 26 80 3.15 3.92
1h5oA00 76.22 CrotamineCrotalus durissus terrificus 2.20.20.10 42 11 76 3.19 4.19
1b8wA00 74.75 Ornithorhynchus anatinusDefensin-like peptide 1Extracellular regionPathogenesis 2.20.20.10 42 7 67 3.13 4.64
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1atxA00
GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1atxA00
GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1atx000" to "1atxA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:46

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"