Set cath from cathlist by auto on 05 Mar 2006 18:14
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1aorA01 | 1 | 211 |
| 1aorA02 | 242 | 427 |
| 1aorA03 | 212 | 241 |
| 1aorA03 | 428 | 604 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1aorA03 ADKQKFMLVVREKVNKLRNDPVAGGGLPKYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDVSDDKIKM LILFQDLTALIDSAGLCLFTTFGLGADDYRDLLNAALGWDFTTEDYLKIGERIWNAERLFNLKAGLDPARDDTLPKRFLE EPMPEGPNKGHTVRLKEMLPRYYKLRGWTEDGKIPKEKLEELGIAEF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"