CATH Domain: 1aopA03 XML data for domain: 1aopA03

Molscript image for 1aopA03
1aopA03
PDB coordinates for domain 1aopA03

PDB 1aop, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.413 Sulfite Reductase Hemoprotein; domain 1
3.30.413.10 Sulfite Reductase Hemoprotein, domain 1 Gene3D
3.30.413.10.2
3.30.413.10.2.1
3.30.413.10.2.1.1
3.30.413.10.2.1.1.1
3.30.413.10.2.1.1.1.1

[top]
Segment boundaries for domain 1aopA03

Chopping figure for domain 1aopA03
DomainStart PDB ResidueStop PDB Residue
1aopA01 149 340
1aopA02 81 145
1aopA02 341 424
1aopA03 425 567

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1aopA03
TPQRENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVSDEHIVMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLH
LGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1aopA03
TPQRENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVSDEHIVMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLH
LGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARD
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1aop003" to "1aopA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:08

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"