CATH Domain: 1aoeA00 XML data for domain: 1aoeA00

Molscript image for 1aoeA00
1aoeA00
PDB coordinates for domain 1aoeA00

PDB 1aoe, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.5
3.40.430.10.5.1
3.40.430.10.5.1.1
3.40.430.10.5.1.1.1
3.40.430.10.5.1.1.1.1

[top]
Segment boundaries for domain 1aoeA00

Chopping figure for domain 1aoeA00
DomainStart PDB ResidueStop PDB Residue
1aoeA00 1 192

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.430.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fziA00 88.45 Pneumocystis cariniiDihydrofolate reductase 3.40.430.10 206 34 90 2.45 2.71
1qzfA01 87.40 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 28 90 2.08 2.31
3ix9A00 85.81 One carbon pool by folateDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3]Metabolic pathways 3.40.430.10 166 24 82 2.49 3.03
2bl9A00 85.66 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 26 81 2.92 3.58
3dfrA00 85.43 One carbon pool by folateLactobacillus caseiDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 162 26 81 2.48 3.05
1cz3B00 83.67 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 20 82 2.83 3.44
1vdrA00 82.92 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 23 79 2.37 2.97
1juvA00 82.16 Dihydrofolate reductaseEnterobacteria phage T4 3.40.430.10 193 13 82 4.13 4.98
2hxvA02 79.83 Riboflavin metabolismMetabolic pathwaysThermotoga maritimaDiaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]Riboflavin-specific deaminase 3.40.430.10 193 10 78 3.72 4.75
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1aoeA00
MLKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWESIPQKFRPLPDRLNIILSRS
YENEIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNELINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQP
KSELQKFVGDTVLEDDIKEGDFTYNYTLWTRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1aoeA00
MLKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWESIPQKFRPLPDRLNIILSRS
YENEIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNELINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQP
KSELQKFVGDTVLEDDIKEGDFTYNYTLWTRK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"