CATH Domain: 1amuA04 XML data for domain: 1amuA04

Molscript image for 1amuA04
1amuA04
PDB coordinates for domain 1amuA04

PDB 1amu, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.30 Gene3D
3.30.300.30.6
3.30.300.30.6.1
3.30.300.30.6.1.1
3.30.300.30.6.1.1.1
3.30.300.30.6.1.1.1.1

[top]
Segment boundaries for domain 1amuA04

Chopping figure for domain 1amuA04
DomainStart PDB ResidueStop PDB Residue
1amuA01 36 205
1amuA02 206 345
1amuA03 346 426
1amuA04 435 530

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.300.30.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lciA04 87.23 Photinus pyralisLuciferin 4-monooxygenasePeroxisome 3.30.300.30 99 20 88 2.05 2.31
2yy3A00 75.98 Pyrococcus horikoshiiElongation factor 1-betaElongation factor EF-1 beta subunit 3.30.70.60 89 5 73 3.46 4.68
3proC01 72.57 Lysobacter enzymogenesAlpha-lytic protease 3.30.300.50 79 2 61 3.03 4.93
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1amuA04
IRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKHIPLEQLRQFSSEELPTYMIPSYFIQLDKMPLTS
NGKIDRKQLPEPDLTF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1amuA04
IRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKHIPLEQLRQFSSEELPTYMIPSYFIQLDKMPLTS
NGKIDRKQLPEPDLTF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:08

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"