CATH Domain: 1aluA00 XML data for domain: 1aluA00

Molscript image for 1aluA00
1aluA00
PDB coordinates for domain 1aluA00

PDB 1alu, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.10
1.20.1250.10.10.1
1.20.1250.10.10.1.1
1.20.1250.10.10.1.1.1
1.20.1250.10.10.1.1.1.1

[top]
Segment boundaries for domain 1aluA00

Chopping figure for domain 1aluA00
DomainStart PDB ResidueStop PDB Residue
1aluA00 19 184

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i1rB00 89.15 Interleukin-6 homologHuman herpesvirus 8 1.20.1250.10 167 24 92 2.13 2.29
1cnt200 85.61 Jak-STAT signaling pathwayCiliary neurotrophic factorCiliary neurotrophic factor receptor bindingCiliary neurotrophic factorCytokine-cytokine receptor interaction 1.20.1250.10 130 11 75 1.83 2.43
3d48P00 85.15 Jak-STAT signaling pathwayPositive regulation of JAK-STAT cascadeRegulation of multicellular organism growthProlactin receptor bindingCell proliferation 1.20.1250.10 165 14 90 3.57 3.95
1evsA00 83.82 Jak-STAT signaling pathwayOncostatin-M receptor complexCytokine activityOncostatin MCell proliferation 1.20.1250.10 163 14 82 3.42 4.13
1ax8A00 83.16 Jak-STAT signaling pathwayLeptinNeuroactive ligand-receptor interactionAdipocytokine signaling pathwayCytokine-cytokine receptor interaction 1.20.1250.10 130 13 78 3.91 4.95
1lkiA00 83.02 Negative regulation of ERK1 and ERK2 cascadeCytokine activityLung vasculature developmentBlood vessel remodelingLung lobe morphogenesis 1.20.1250.10 172 10 81 3.19 3.92
1f45B00 79.54 Positive regulation of interferon-gamma productionPositive regulation of tyrosine phosphorylation of Stat4 proteinPositive regulation of smooth muscle cell apoptosisPositive regulation of cell adhesionInterleukin-27 binding 1.20.1250.10 133 9 70 2.97 4.24
2oyqA04 69.46 DNA polymeraseEnterobacteria phage RB69 1.10.287.690 49 4 29 1.12 3.82
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1aluA00
LTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFES
SEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1aluA00
LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL
EYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSL
RALRQM
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1alu000" to "1aluA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"