CATH Domain: 1ajsA01 XML data for domain: 1ajsA01

Molscript image for 1ajsA01
1ajsA01
PDB coordinates for domain 1ajsA01

PDB 1ajs, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.20
3.90.1150.10.20.1
3.90.1150.10.20.1.1
3.90.1150.10.20.1.1.1
3.90.1150.10.20.1.1.1.1

[top]
Segment boundaries for domain 1ajsA01

Chopping figure for domain 1ajsA01
DomainStart PDB ResidueStop PDB Residue
1ajsA01 15 48
1ajsA01 328 408
1ajsA02 49 327

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1arsA01 93.68 Tyrosine metabolismArginine and proline metabolismMetabolic pathwaysPhenylalanine metabolismCysteine and methionine metabolism 3.90.1150.10 115 32 100 0.94 0.94
3tatA01 85.61 Tyrosine metabolismPhenylalanine metabolismMetabolic pathwaysCysteine and methionine metabolismNovobiocin biosynthesis 3.90.1150.10 155 36 74 1.49 2.01
3k40A03 77.95 Aromatic-L-amino-acid decarboxylase activityDopamine biosynthetic process from tyrosineAromatic-L-amino-acid decarboxylaseDevelopmental pigmentationSerotonin biosynthetic process from tryptophan 3.90.1150.10 99 12 66 2.84 4.24
1uu2B01 77.51 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 13 79 3.73 4.69
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ajsA01
VLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWDRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYL
INQKHIYLLPSGRINMCGLTTKNLDYVATSIHEAV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ajsA01
VLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWDRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYL
INQKHIYLLPSGRINMCGLTTKNLDYVATSIHEAV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:08

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"