Set cath from cathlist by auto on 05 Mar 2006 19:26
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ad3A01 | 3 | 210 |
| 1ad3A01 | 408 | 446 |
| 1ad3A02 | 213 | 407 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.309.10.9.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1o20A02 | 80.99 | 3.40.309.10 | 149 | 19 | 68 | 2.44 | 3.58 |
>pdb|1ad3A02 KSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQR VKGLIDNQKVAHGGTWDQSSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKV IKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"