Set cath from cathlist by auto on 05 Mar 2006 19:27
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ad3A01 | 3 | 210 |
| 1ad3A01 | 408 | 446 |
| 1ad3A02 | 213 | 407 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ad3A01 ISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYYEEVAHVLEELDTTIKELPDWAE DEPVAKTRQTQQDDLYIHSEPLGVVLVIGAWNYPFNLTIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQYMDQNLY LVVKGGVPETTELLKERFDHIMYTGSTAVGKIVMAAAAKHLTPVTLELGMGAYHGKKSFETFSHRRSCLVKSLLNEEAHK ARYPPSP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"