CATH Domain: 1abrA02 XML data for domain: 1abrA02

Molscript image for 1abrA02
1abrA02
PDB coordinates for domain 1abrA02

PDB 1abr, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.470 Ricin (A Subunit), domain 2
4.10.470.10 Ricin (A Subunit), domain 2 Gene3D
4.10.470.10.9
4.10.470.10.9.1
4.10.470.10.9.1.1
4.10.470.10.9.1.1.1
4.10.470.10.9.1.1.1.1

[top]
Segment boundaries for domain 1abrA02

Chopping figure for domain 1abrA02
DomainStart PDB ResidueStop PDB Residue
1abrA01 1 166
1abrA02 167 251

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.470.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hwmA02 91.87 Sambucus ebulusRibosome-inactivating protein 4.10.470.10 86 40 94 1.60 1.70
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1abrA02
RFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFV
CNPPN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1abrA02
RFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFV
CNPPN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"