CATH Domain: 1ab4A02 XML data for domain: 1ab4A02

Molscript image for 1ab4A02
1ab4A02
PDB coordinates for domain 1ab4A02

PDB 1ab4, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.40 Gene3D
3.30.1360.40.6
3.30.1360.40.6.1
3.30.1360.40.6.1.1
3.30.1360.40.6.1.1.1
3.30.1360.40.6.1.1.1.1

[top]
Segment boundaries for domain 1ab4A02

Chopping figure for domain 1ab4A02
DomainStart PDB ResidueStop PDB Residue
1ab4A01 30 235
1ab4A01 334 369
1ab4A01 494 522
1ab4A02 236 333
1ab4A03 370 493

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1360.40.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3l4jA04 82.38 Reciprocal meiotic recombinationRegulation of mitotic recombinationDNA topoisomerase 2DNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1360.40 102 11 83 3.11 3.73
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ab4A02
GRGKVYIRARAEVEVETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEGEVVLNNLYSQTQLQ
VSFGIN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ab4A02
GRGKVYIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEV
VLNNLYSQTQLQVSFGIN
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ab4002" to "1ab4A02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"