CATH Domain: 1aapA00 XML data for domain: 1aapA00

Molscript image for 1aapA00
1aapA00
PDB coordinates for domain 1aapA00

PDB 1aap, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.410 Factor Xa Inhibitor
4.10.410.10 Factor Xa Inhibitor Gene3D
4.10.410.10.3
4.10.410.10.3.1
4.10.410.10.3.1.1
4.10.410.10.3.1.1.1
4.10.410.10.3.1.1.1.1

[top]
Segment boundaries for domain 1aapA00

Chopping figure for domain 1aapA00
DomainStart PDB ResidueStop PDB Residue
1aapA00 1 56

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 4.10.410.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y62A00 95.56 Conkunitzin-S1Conus striatus 4.10.410.10 56 30 100 0.91 0.91
1dtxA00 95.20 Dendroaspis angusticepsVenom basic protease inhibitor 1 homolog 4.10.410.10 58 33 96 0.91 0.94
1bunB00 90.24 Bungarus multicinctusBeta-bungarotoxin B2 chain 4.10.410.10 61 28 91 1.44 1.57
1tocR02 87.45 OrnithodorinOrnithodoros moubata 4.10.410.10 58 19 89 2.11 2.35
1tocR01 84.48 OrnithodorinOrnithodoros moubata 4.10.410.10 52 9 85 2.69 3.14
1d0dA00 83.54 Ornithodoros moubataTick anticoagulant peptide 4.10.410.10 60 10 91 3.82 4.17
1bikA00 81.85 Protein homodimerization activityPlasma membraneNegative regulation of JNK cascadeSerine-type endopeptidase inhibitor activityIgA binding 4.10.410.10 110 41 48 0.55 1.14
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1aapA00
VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1aapA00
VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"