CATH Domain: 1a9xA06 XML data for domain: 1a9xA06

Molscript image for 1a9xA06
1a9xA06
PDB coordinates for domain 1a9xA06

PDB 1a9x, Chain A, Domain 6

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.5
3.30.470.20.5.1
3.30.470.20.5.1.1
3.30.470.20.5.1.1.1
3.30.470.20.5.1.1.1.1

[top]
Segment boundaries for domain 1a9xA06

Chopping figure for domain 1a9xA06
DomainStart PDB ResidueStop PDB Residue
1a9xA01 1 116
1a9xA02 117 140
1a9xA02 211 403
1a9xA03 141 210
1a9xA04 404 553
1a9xA05 554 663
1a9xA06 664 686
1a9xA06 757 936
1a9xA07 687 756
1a9xA08 937 1042

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.470.20.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ethA02 80.48 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.470.20 223 10 81 2.98 3.65
1iowA02 78.09 D-Alanine metabolismPeptidoglycan biosynthesisD-alanine--D-alanine ligase BD-alanine-D-alanine ligase [EC:6.3.2.4]Escherichia coli K-12 3.30.470.20 149 14 65 2.92 4.49
2pn1A03 76.10 Pyrimidine metabolismExiguobacterium sibiricum 255-15Alanine, aspartate and glutamate metabolismCarbamoyl-phosphate synthase large subunit [EC:6.3.5.5]Metabolic pathways 3.30.470.20 116 18 56 2.57 4.54
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1a9xA06
TSPDAIDRAEDRERFQHAVERLKDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQV
QKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAGKSLAEQGVTKEVIPPYYSVKEV
VLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAKAQLGSN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a9xA06
TSPDAIDRAEDRERFQHAVERLKDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQV
QKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAGKSLAEQGVTKEVIPPYYSVKEV
VLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAKAQLGSN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:06

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"