CATH Domain: 1a8oA00 XML data for domain: 1a8oA00

Molscript image for 1a8oA00
1a8oA00
PDB coordinates for domain 1a8oA00

PDB 1a8o, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.30 Gene3D
1.10.1200.30.2
1.10.1200.30.2.1
1.10.1200.30.2.1.1
1.10.1200.30.2.1.1.1
1.10.1200.30.2.1.1.1.1

[top]
Segment boundaries for domain 1a8oA00

Chopping figure for domain 1a8oA00
DomainStart PDB ResidueStop PDB Residue
1a8oA00 152 220

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1200.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eiaA02 90.36 Gag polyproteinEquine infectious anemia virus (ISOLATE WYOMING) 1.10.1200.30 74 43 89 1.67 1.87
1qrjB02 83.41 Gag-Pro-Pol polyproteinHuman T-cell lymphotrophic virus type 1 (strain ATK) 1.10.1200.30 81 28 81 2.48 3.04
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1a8oA00
DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWTETLLVQNANPDCKTILKALGPGATLEETACQG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a8oA00
XDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWXTETLLVQNANPDCKTILKALGPGATLEEXXTACQG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1a8o000" to "1a8oA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"