Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1a7cA01 | 33 | 170 |
| 1a7cA01 | 281 | 325 |
| 1a7cA01 | 350 | 359 |
| 1a7cA02 | 171 | 280 |
| 1a7cA02 | 326 | 349 |
There are 9 matching structural neighberhood comparisons for CATH ID 2.30.39.10.7.1.1.1.1 (SIMAX score < 5)
>pdb|1a7cA02 FNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSAL TNILSAQLISHWKGNMTRLPRLLVLPKFSLIEVNESGTAP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"