CATH Domain: 1a5tA02 XML data for domain: 1a5tA02

Molscript image for 1a5tA02
1a5tA02
PDB coordinates for domain 1a5tA02

PDB 1a5t, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.10 DNA helicase RuvA subunit, C-terminal domain Gene3D
1.10.8.10.11
1.10.8.10.11.1
1.10.8.10.11.1.1
1.10.8.10.11.1.1.1
1.10.8.10.11.1.1.1.1

[top]
Segment boundaries for domain 1a5tA02

Chopping figure for domain 1a5tA02
DomainStart PDB ResidueStop PDB Residue
1a5tA01 1 167
1a5tA02 168 207
1a5tA03 208 329

Structural Neighbourhood (40 entries)

There are 40 matching structural neighberhood comparisons for CATH ID 1.10.8.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 40 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dv0A00 89.22 Nucleotide excision repairNucleotide-excision repairUV excision repair protein RAD23 homolog ASingle-stranded DNA bindingHomo sapiens 1.10.8.10 45 12 86 1.34 1.55
1otrA00 88.17 Saccharomyces cerevisiaeProtein bindingUbiquitin-binding protein CUE2 1.10.8.10 49 12 81 1.30 1.59
1ifyA00 87.57 Nucleotide excision repairNucleotide-excision repairUV excision repair protein RAD23 homolog ASingle-stranded DNA bindingHomo sapiens 1.10.8.10 49 20 79 1.59 2.00
1v92A00 86.71 Rattus norvegicusGolgi organizationCellular membrane fusionNSFL1 cofactor p47Protein binding 1.10.8.10 46 20 86 1.68 1.93
1bvsF03 84.36 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAMycobacterium lepraeHolliday junction DNA helicase RuvA 1.10.8.10 45 10 80 2.21 2.76
1ixrB03 84.16 Homologous recombinationThermus thermophilus HB8Holliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAProtein binding 1.10.8.10 53 15 71 1.90 2.65
3bosA02 82.14 DnaA-homolog proteinShewanella amazonensis SB2BRegulatory inactivation of DnaA Hda protein 1.10.8.60 59 10 61 1.43 2.34
3bg5B07 81.86 Citrate cycle (TCA cycle)Pyruvate metabolismMetabolic pathwaysPyruvate carboxylase subunit A [EC:6.4.1.1]Pyruvate carboxylase subunit B [EC:6.4.1.1] 1.10.10.60 46 10 82 2.38 2.88
1q02A00 81.83 Positive regulation of transcription from RNA polymerase II promoterProtein localizationProtein kinase C bindingCytosolUbiquitin binding 1.10.8.10 52 17 76 2.43 3.16
1sxjE02 81.65 Leading strand elongationNucleotide excision repairDNA replicationReplication factor C subunit 3/5Sister chromatid cohesion 1.10.8.60 64 25 62 1.90 3.04
1j09A04 81.31 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Porphyrin and chlorophyll metabolismGlutamyl-tRNA synthetase [EC:6.1.1.17]Glutamyl-tRNA synthetase 1.10.8.70 48 10 83 3.36 4.03
2chgA02 80.53 Archaeoglobus fulgidusReplication factor C small subunitReplication factor C small subunit 1.10.8.60 66 25 60 1.55 2.56
1njgA02 80.45 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 66 22 60 1.69 2.79
3b7nA01 80.13 CRAL-TRIO domain-containing protein YKL091CNucleusSaccharomyces cerevisiae 1.10.8.20 79 17 50 1.18 2.33
1tteA02 79.64 Ubiquitin-conjugating enzyme E2-24 kDaIdentical protein bindingProtein polyubiquitinationUbiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:6.3.2.19]Ubiquitin mediated proteolysis 1.10.8.10 57 7 68 2.26 3.30
1wivA00 79.39 Embryo development ending in seed dormancyUbiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]Ubiquitin carboxyl-terminal hydrolase 14Arabidopsis thalianaUbiquitin-specific protease activity 1.10.8.10 73 22 53 1.94 3.63
1sxjD02 79.29 DNA replicationNucleotide excision repairLeading strand elongationCell cycle checkpointProtein binding 1.10.8.60 70 22 57 1.69 2.96
1l8qA02 79.02 Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAAquifex aeolicus 1.10.8.60 49 5 79 2.21 2.78
1njgB01 78.82 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 73 22 54 1.72 3.14
1s26D01 78.69 Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 59 7 66 2.22 3.36
1in4A03 78.30 Holliday junction DNA helicase RuvBThermotoga maritimaHomologous recombinationHolliday junction ATP-dependent DNA helicase ruvB 1.10.8.60 75 17 53 1.68 3.15
1jr3D03 77.96 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 71 10 56 1.52 2.70
1deeG00 77.82 Staphylococcus aureus subsp. aureus NCTC 8325Immunoglobulin G-binding protein A 1.20.5.420 51 10 78 3.47 4.42
1r7rA06 77.64 Mus musculusPolyubiquitin bindingProtein complexAggresome assemblyTransitional endoplasmic reticulum ATPase 1.10.8.60 58 7 68 3.44 4.99
2fmpA02 77.45 DNA-dependent DNA replicationDNA-directed DNA polymerase activityDNA polymerase betaCytoplasmBase excision repair 1.10.150.20 57 7 66 2.65 3.98
1vq8P03 77.14 50S ribosomal protein L19eRibosomeLarge subunit ribosomal protein L19eHaloarcula marismortui 1.10.1200.60 55 10 72 3.10 4.26
1sxjC02 77.05 Nucleotide excision repairDNA replicationLeading strand elongationReplication factor C subunit 3Replication factor C subunit 3/5 1.10.8.60 69 22 57 1.61 2.78
1nv8B01 76.35 Thermotoga maritimaMethyltransferase [EC:2.1.1.-]HemK protein 1.10.8.10 71 12 56 2.54 4.51
1okkD01 76.06 Cell division protein ftsYThermus aquaticusProtein binding 1.20.120.140 58 12 67 3.00 4.46
1m45A01 75.92 Vesicle targetingIdentical protein bindingProtein localizationMyosin II heavy chain bindingMyosin light chain 1 1.10.238.10 67 5 59 2.26 3.79
1r6bX03 75.75 ATP-dependent Clp protease ATP-binding subunit clpAATP-dependent Clp protease ATP-binding subunit ClpAProtein bindingEscherichia coli K-12 1.10.8.60 88 17 44 1.75 3.95
2j5yA00 74.97 Peptostreptococcal albumin-binding proteinFinegoldia magna 1.10.8.40 61 12 62 3.08 4.94
1i2tA00 74.76 Progesterone receptor signaling pathwayE3 ubiquitin-protein ligase EDD1 [EC:6.3.2.19]NucleusSoluble fractionUbiquitin mediated proteolysis 1.10.1900.10 61 20 65 3.09 4.71
1qzmA00 73.63 Serine-type endopeptidase activityATP-dependent Lon protease [EC:3.4.21.53]ATP-dependent protease LaResponse to heatProteolysis 1.10.8.60 94 10 42 1.86 4.37
1djxB01 73.61 Calcium ion bindingCalcium signaling pathwayPhosphatidylinositol signaling systemRattus norvegicusElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger 1.10.238.10 52 5 75 3.74 4.99
1jqjD03 73.35 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 86 10 46 1.64 3.53
1fnnA01 73.01 Pyrobaculum aerophilumCell division control protein 6 (Cdc6), putativeArchaeal cell division control protein 6 1.10.8.60 101 15 39 1.91 4.82
1tgrA00 72.90 Positive regulation of smooth muscle cell proliferationPositive regulation of DNA replicationPositive regulation of gene-specific transcriptionRegulation of multicellular organism growthPositive regulation of tyrosine phosphorylation of Stat5 protein 1.10.100.10 52 5 75 3.53 4.71
2z4sA02 72.68 Thermotoga maritimaTwo-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaA 1.10.8.60 72 2 55 2.44 4.39
1g41A02 62.99 ATP-dependent hsl protease ATP-binding subunit hslUHaemophilus influenzaeATP-dependent HslUV protease ATP-binding subunit HslU 1.10.8.10 30 6 50 2.49 4.98
[1]
Displaying entries 1 to 40 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1a5tA02
PEQYAVTWLSREVTMSQDALLAALRLSAGSPGAALALFQG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a5tA02
PEQYAVTWLSREVTMSQDALLAALRLSAGSPGAALALFQG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1a5t002" to "1a5tA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:06

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"