Set cath from cathlist by auto on 05 Mar 2006 19:27
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1a4sA01 | 6 | 265 |
| 1a4sA02 | 266 | 461 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.605.10.11.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1t90A01 | 88.34 | 3.40.605.10 | 280 | 31 | 88 | 1.69 | 1.90 | |
![]() |
1ad3A01 | 82.14 | 3.40.605.10 | 247 | 22 | 77 | 2.38 | 3.08 |
>pdb|1a4sA01 SMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRV MLEAARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAW NYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPT GKKVMEMSAKTVKHVTLELG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"