CATH Domain: 1a3qA01 XML data for domain: 1a3qA01

Molscript image for 1a3qA01
1a3qA01
PDB coordinates for domain 1a3qA01

PDB 1a3q, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.340 Gene3D
2.60.40.340.1
2.60.40.340.1.1
2.60.40.340.1.1.1
2.60.40.340.1.1.1.1
2.60.40.340.1.1.1.1.1

[top]
Segment boundaries for domain 1a3qA01

Chopping figure for domain 1a3qA01
DomainStart PDB ResidueStop PDB Residue
1a3qA01 37 221
1a3qA02 225 322

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.60.40.340.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1p7hL01 82.94 Nuclear factor of activated T-cells, cytoplasmic 2Sequence-specific DNA binding transcription factor activityTranscription activator activityNucleusHomo sapiens 2.60.40.340 173 16 79 2.28 2.87
3iagC01 73.28 Transcription factor bindingHeart developmentRegulation of timing of cell differentiationDefense response to bacteriumChromatin binding 2.60.40.1450 166 7 55 2.57 4.65
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1a3qA01
GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSE
LGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSA
FLRSLPLKPVISQPIHDSK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a3qA01
GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSE
LGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSA
FLRSLPLKPVISQPIHDSK
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 24 Nov 2007 03:34

Assigning to "2.60.40.340" based on similarity with "1a3qB01"

Flow stage update by auto on 24 Nov 2007 03:31

No in_process hits for Domain "1a3qA01" ready to be processed

Update comment by auto on 24 Nov 2007 03:22

Domain "1a3qA01" hits Domain "1a3qB01" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:15

Domain "1a3qA01" hits Domain "2ramB01" (40.8284023668639% over 91.6201117318436%) which is currently in process

Update comment by auto on 24 Nov 2007 03:09

Domain "1a3qA01" hits Domain "2ramA01" (40.8284023668639% over 91.6201117318436%) which is currently in process

Update comment by auto on 24 Nov 2007 02:58

Domain "1a3qA01" hits Domain "1ramA01" (40.8284023668639% over 91.6201117318436%) which is currently in process

Update comment by auto on 24 Nov 2007 02:40

Domain "1a3qA01" hits Domain "1ramB01" (40.8284023668639% over 91.6201117318436%) which is currently in process

Update comment by auto on 23 Nov 2007 14:06

Domain "1a3qA01" hits Domain "1vkxA01" (40.2366863905325% over 91.6201117318436%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:03

Domain "1a3qA01" hits Domain "1vkxA01" (40.2366863905325% over 91.6201117318436%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:02

NW result present for Domain "1a3qA01"

Flow stage update by auto on 23 Nov 2007 14:01

All required files are present for Domain "1a3qA01"

Flow stage update by auto on 13 Nov 2007 00:10

Beginning processing for Domain "1a3qA01"

Insertion by auto on 12 Nov 2007 21:39

Final ChopClose added based on similarity with "1a3qB"