Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1a35A01 | 236 | 319 |
| 1a35A02 | 320 | 430 |
| 1a35A03 | 431 | 580 |
| 1a35A04 | 591 | 635 |
| 1a35A04 | 713 | 764 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1a35A04 TYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAQIALGTSKLNFLDPRITVAWCKKWGVPIEKIYNKT QREKFAWAIDMADEDYE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"