CATH Domain: 1a1wA00 XML data for domain: 1a1wA00

Molscript image for 1a1wA00
1a1wA00
PDB coordinates for domain 1a1wA00

PDB 1a1w, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.13
1.10.533.10.13.1
1.10.533.10.13.1.1
1.10.533.10.13.1.1.1
1.10.533.10.13.1.1.1.1

[top]
Segment boundaries for domain 1a1wA00

Chopping figure for domain 1a1wA00
DomainStart PDB ResidueStop PDB Residue
1a1wA00 1 83

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.533.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1n3kA00 80.16 Astrocytic phosphoprotein PEA-15Cricetulus griseus 1.10.533.10 130 26 63 1.89 2.96
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1a1wA00
MDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVD
DFE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a1wA00
MDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVD
DFELEHHHHHH
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1a1w000" to "1a1wA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:34

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"