CATH Domain: 1a0iA03 XML data for domain: 1a0iA03

Molscript image for 1a0iA03
1a0iA03
PDB coordinates for domain 1a0iA03

PDB 1a0i, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.30 DNA ligase/mRNA capping enzyme Gene3D
3.30.470.30.5
3.30.470.30.5.1
3.30.470.30.5.1.1
3.30.470.30.5.1.1.1
3.30.470.30.5.1.1.1.1

[top]
Segment boundaries for domain 1a0iA03

Chopping figure for domain 1a0iA03
DomainStart PDB ResidueStop PDB Residue
1a0iA01 2 36
1a0iA01 193 240
1a0iA02 241 349
1a0iA03 37 192

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1a0iA03
GVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTK
NQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a0iA03
GVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTK
NQEFHEELFVEPIRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQA
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1a0i003" to "1a0iA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:05

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"