CATH Domain: 1a0iA01 XML data for domain: 1a0iA01

Molscript image for 1a0iA01
1a0iA01
PDB coordinates for domain 1a0iA01

PDB 1a0i, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.70 Gene3D
3.30.1490.70.6
3.30.1490.70.6.1
3.30.1490.70.6.1.1
3.30.1490.70.6.1.1.1
3.30.1490.70.6.1.1.1.1

[top]
Segment boundaries for domain 1a0iA01

Chopping figure for domain 1a0iA01
DomainStart PDB ResidueStop PDB Residue
1a0iA01 2 36
1a0iA01 193 240
1a0iA02 241 349
1a0iA03 37 192

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1490.70.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x9nA02 84.40 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 26 85 2.63 3.07
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1a0iA01
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWW
KMK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1a0iA01
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWW
KMK
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1a0i001" to "1a0iA01" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:05

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"