Flow stage update by cuff on 04 Dec 2008 15:46
nice chopping
PDB Chain: 3cwvA
3cwvA
PDB 3cwv, Chain A
CATH Domains (2)
| Domain ID | CATH code | Image |
|---|---|---|
| 3cwvA01 | 3.30.565.10 | |
| 3cwvA02 | 3.30.230.10 |
Chain ATOM Sequence
>pdb|3cwvA GGIVENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGSIALFCTSRTVTAENLVRVATGAGFL GRPPGDGWGWDSMLVVSLALSSRYQVDIWADGRQWRVMGEHGHPQGEGAAVTPMEPMPVSAERGVRVHFVPDATIFEVLA FDRARLSRRCNELAALAPGLRVSFADLQRGERTLWHLPGGVAQWAHVLTEARPQLHPEPVVFDFTWDGLRVQCALQWCED EDSTLLSFANAVRTVRHGAHVKGVTQALRGALAKLSGETRGAFPWARVAQGLTAIVAVSGPRRQMAFAGPTKELLAIPGL EEAIRKQLQPLFIELLREHPVTPALLARR
Chain COMBS Sequence
>pdb|3cwvA MSLGMHLPGGIVENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGSIALFCTSRTVTAENLVR VATGAGFLGRPPGDGWGWDSMLVVSLALSSRYQVDIWADGRQWRVMGEHGHPQGEGAAVTPMEPMPVSAERGVRVHFVPD ATIFEVLAFDRARLSRRCNELAALAPGLRVSFADLQRGERTLWHLPGGVAQWAHVLTEARPQLHPEPVVFDFTWDGLRVQ CALQWCEDEDSTLLSFANAVRTVRHGAHVKGVTQALRGALAKLSGETRGAFPWARVAQGLTAIVAVSGPRRQMAFAGPTK ELLAIPGLEEAIRKQLQPLFIELLREHPVTPALLARRTSGSEGHHHHHH
Chain History Events (38)
Chain chopped by cuff on 04 Dec 2008 15:46
nice chopping
Domchop review by garner on 12 Jun 2008 15:57
Two domain protein
Flow stage update by garner on 12 Jun 2008 15:57
Two domain protein
Domchop allotment by garner on 12 Jun 2008 15:56
User 'garner' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by garner on 12 Jun 2008 15:56
User 'garner' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 14 May 2008 11:09
Retrieved HMM(SAM) results for job ID SID2737192489721880 and inserted them into the database.
Chain chopping hmm by auto on 14 May 2008 11:08
Chain HMM chopping
Update comment by auto on 14 May 2008 08:23
HMM(SAM) job SID2737192489721880 is not yet finished.
Hmm submit by auto on 14 May 2008 08:20
The entry "3cwvA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 May 2008 08:20
The entry "3cwvA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 May 2008 05:14
Unable to retrieve "3cwvA" HMM(SAM) results for job "SID6399943038358624"
Update comment by auto on 14 May 2008 02:33
HMM(SAM) job SID6399943038358624 is not yet finished.
Hmm submit by auto on 14 May 2008 02:31
The entry "3cwvA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 May 2008 02:31
The entry "3cwvA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 May 2008 02:27
Retrieved "3cwvA" CATHEDRAL results for job ID SID2655068052049536 and inserted them into the database.
Chain chopping cathedral by auto on 14 May 2008 02:27
Chain "3cwvA" CATHEDRAL chopping from job SID2655068052049536
Update comment by auto on 13 May 2008 23:14
"3cwvA" CATHEDRAL job SID2655068052049536 is not yet finished.
Cathedral submit by auto on 13 May 2008 23:12
The entry "3cwvA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 13 May 2008 23:12
The entry "3cwvA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 13 May 2008 23:09
ScanList with 11741 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cwvA.scanlist" for "3cwvA"
Update comment by auto on 13 May 2008 20:13
Waiting for 27 new domains (example : 3c63D00) to be processed so that they can be scanned against too.
Update comment by auto on 13 May 2008 17:10
Waiting for 79 new domains (example : 2yzdE00) to be processed so that they can be scanned against too.
Update comment by auto on 13 May 2008 14:10
Waiting for 131 new domains (example : 2qo0B01) to be processed so that they can be scanned against too.
Update comment by auto on 12 May 2008 12:29
Waiting for 147 new domains (example : 2pq1A01) to be processed so that they can be scanned against too.
Update comment by auto on 12 May 2008 08:19
Waiting for 35 new domains (example : 2pq1A01) to be processed so that they can be scanned against too.
Flow stage update by auto on 12 May 2008 08:19
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_PUU) for Chain "3cwvA"
Chain chopping puu by auto on 12 May 2008 08:19
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Chain chopping detective by auto on 12 May 2008 08:19
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Flow stage update by auto on 12 May 2008 08:15
Number of chains in ballcock flow stages is 611 which is less than the max allowed of 800
Flow stage update by auto on 12 May 2008 08:15
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 12 May 2008 08:15
Putative ChopClose added based on similarity with "1kijA"
Flow stage update by auto on 12 May 2008 07:57
No in_process hits for Chain "3cwvA" ready to be processed
Flow stage update by auto on 12 May 2008 07:57
NW result present for Chain "3cwvA"
Flow stage update by auto on 12 May 2008 07:57
All required files are present for Chain "3cwvA"
Flow stage update by auto on 11 May 2008 19:57
Beginning processing for Chain "3cwvA"
Flow stage update by auto on 11 May 2008 17:02
Chain passed the SIFT criteria
Insertion by auto on 11 May 2008 17:02
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
